PDB entry 1t6q

View 1t6q on RCSB PDB site
Description: Nickel Superoxide Dismutase (NiSOD) CN-treated Apo Structure
Class: oxidoreductase
Keywords: Nickel, 4-helix bundle, hexamer, superoxide dismutase, NiSOD, SOD, apo, cyanide, oxidoreductase
Deposited on 2004-05-07, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.217
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735
      • engineered (84)
    Domains in SCOPe 2.07: d1t6qa_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (Start-116)
      • engineered (84)
    Domains in SCOPe 2.07: d1t6qb_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SODN, SOD1, SCO5254, 2SC7G11.16C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735
      • engineered (84)
    Domains in SCOPe 2.07: d1t6qc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6qA (A:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6qA (A:)
    gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp
    hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6qB (B:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6qB (B:)
    cgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkp
    phfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t6qC (C:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6qC (C:)
    gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp
    hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk