PDB entry 1t6q

View 1t6q on RCSB PDB site
Description: nickel superoxide dismutase (nisod) cn-treated apo structure
Deposited on 2004-05-07, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.217
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t6qa_
  • Chain 'B':
    Domains in SCOP 1.69: d1t6qb_
  • Chain 'C':
    Domains in SCOP 1.69: d1t6qc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6qA (A:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6qA (A:)
    gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp
    hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6qB (B:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6qB (B:)
    cgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkp
    phfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t6qC (C:)
    hcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6qC (C:)
    gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp
    hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk