PDB entry 1t6p

View 1t6p on RCSB PDB site
Description: crystal structure of phenylalanine ammonia lyase from rhodosporidium toruloides
Deposited on 2004-05-06, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t6pa_
  • Chain 'B':
    Domains in SCOP 1.71: d1t6pb_
  • Chain 'C':
    Domains in SCOP 1.71: d1t6pc_
  • Chain 'D':
    Domains in SCOP 1.71: d1t6pd_
  • Chain 'E':
    Domains in SCOP 1.71: d1t6pe_
  • Chain 'F':
    Domains in SCOP 1.71: d1t6pf_
  • Chain 'G':
    Domains in SCOP 1.71: d1t6pg_
  • Chain 'H':
    Domains in SCOP 1.71: d1t6ph_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6pA (A:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pA (A:)
    tnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkds
    deirskidksveflrsedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrga
    mtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisgh
    pdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahm
    lsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6pB (B:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pB (B:)
    stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
    sdeirskidksveflrsqsadtrtedaislqkallehqlcgvlpssfdsfrlgrglensl
    plevvrgamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsy
    iaaaisghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmat
    lalhdahmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsr
    favhhedryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfq
    aaavantmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaa
    aaytselghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqa
    idlraiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlv
    prwhdafsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspa
    lsylsprtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkm
    la
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t6pC (C:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pC (C:)
    stnlavagttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdei
    rskidksveflrsqdaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamti
    rvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpds
    kvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsl
    lsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhhrqdryp
    lrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmek
    trlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghl
    anpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefef
    kkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfa
    agtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqi
    lyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t6pD (D:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pD (D:)
    stnlavatqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirs
    kidksveflrsqtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgam
    tirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghp
    dskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahml
    sllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhqdryp
    lrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmek
    trlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghl
    anpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefef
    kkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfa
    agtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqi
    lyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t6pE (E:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pE (E:)
    stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
    sdeirskidksveflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevv
    rgamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaai
    sghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhd
    ahmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhh
    qdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaava
    ntmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaayts
    elghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlra
    iefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhd
    afsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsyls
    prtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t6pF (F:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pF (F:)
    stnlavattqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeir
    skidksveflrsqedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamti
    rvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpds
    kvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsl
    lsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhhrqdryp
    lrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmek
    trlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghl
    anpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefef
    kkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfa
    agtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqi
    lyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1t6pG (G:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pG (G:)
    stnlavagshlpttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkd
    sdeirskidksveflrsqedaislqkallehqlcgvlpssfdsfrlgrglenslplevvr
    gamtirvnsltrghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaais
    ghpdskvhvvhegkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhda
    hmlsllsqsltamtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhhe
    rqdryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaav
    antmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaayt
    selghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlr
    aiefefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwh
    dafsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsyl
    sprtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1t6pH (H:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6pH (H:)
    ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
    eflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnslt
    rghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvh
    egkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqslt
    amtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheqdryplrtspq
    wlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmektrlgla
    qigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghlanpvtt
    hvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefefkkqfgp
    aivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfaagtvve
    vlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqilyafvr
    eelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla