PDB entry 1t6o

View 1t6o on RCSB PDB site
Description: nucleocapsid-binding domain of the measles virus p protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus n protein
Deposited on 2004-05-06, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t6oa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6oA (A:)
    ggasrsvirsiikssrleedrkrylmtllddikgandlakfhqmlmkiimk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6oA (A:)
    gasrsvirsiikssrleedrkrylmtllddikgandlakfhqmlmkiim