PDB entry 1t6o

View 1t6o on RCSB PDB site
Description: Nucleocapsid-binding domain of the measles virus P protein (amino acids 457-507) in complex with amino acids 486-505 of the measles virus N protein
Class: Viral protein
Keywords: four helix bundle, Viral protein
Deposited on 2004-05-06, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphoprotein
  Species: Measles virus [TaxId:11234]
  Gene: P/V
  Database cross-references and differences (RAF-indexed):
  • GB AAF85668
    • engineered (1)
  Domains in SCOPe 2.08: d1t6oa_
• Chain 'B':
  Compound: Phosphoprotein
  Species: Measles virus [TaxId:11234]
  Gene: N
  Database cross-references and differences (RAF-indexed):
  • GB AAF85667 (0-End)
• Chain 'L':
  Compound: linker
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1T6O (Start-7)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1t6oA (A:)
  ggasrsvirsiikssrleedrkrylmtllddikgandlakfhqmlmkiimk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1t6oA (A:)
  gasrsvirsiikssrleedrkrylmtllddikgandlakfhqmlmkiim
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.