PDB entry 1t6n

View 1t6n on RCSB PDB site
Description: Crystal structure of the N-terminal domain of human UAP56
Class: pre-mRNA processing protein
Keywords: RecA-like fold
Deposited on 2004-05-06, released 2004-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.216
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase
    Species: HOMO SAPIENS
    Gene: BAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t6na_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase
    Species: HOMO SAPIENS
    Gene: BAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t6nb_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6nA (A:)
    gsdvkgsyvsihssgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaks
    gmgktavfvlatlqqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgg
    lsikkdeevlkkncphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdv
    qeifrmtphekqvmmfsatlskeirpvcrkfmqdpmeifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6nA (A:)
    sgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatl
    qqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkkn
    cphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqv
    mmfsatlskeirpvcrkfmqdpmeifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6nB (B:)
    gsdvkgsyvsihssgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaks
    gmgktavfvlatlqqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgg
    lsikkdeevlkkncphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdv
    qeifrmtphekqvmmfsatlskeirpvcrkfmqdpmeifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6nB (B:)
    sgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatl
    qqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkkn
    cphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqv
    mmfsatlskeirpvcrkfmqdpmeifv