PDB entry 1t6m

View 1t6m on RCSB PDB site
Description: X-ray Structure of the R70D PI-PLC enzyme: Insight into the role of calcium and surrounding amino acids on active site geometry and catalysis.
Class: lyase
Keywords: PI-PLC, lyase
Deposited on 2004-05-06, released 2005-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-phosphatidylinositol phosphodiesterase
    Species: BACILLUS THURINGIENSIS [TaxId:1428]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08954 (1-End)
      • engineered (69)
    Domains in SCOPe 2.08: d1t6ma_
  • Chain 'B':
    Compound: 1-phosphatidylinositol phosphodiesterase
    Species: BACILLUS THURINGIENSIS [TaxId:1428]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08954 (1-End)
      • engineered (69)
    Domains in SCOPe 2.08: d1t6mb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6mA (A:)
    massvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqm
    dhgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeye
    dmkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywp
    dnetftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssgg
    tawnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6mA (A:)
    assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
    netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqeviranksli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6mB (B:)
    massvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqm
    dhgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeye
    dmkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywp
    dnetftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssgg
    tawnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6mB (B:)
    assvnelenwskwmqpipdniplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdidgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaegsfsstfeknyfvdpiflktegniklgdargkivllkrysgsnesggynnfywpd
    netftttvnqnvnvtvqdkykvnydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeiandikqknptrvgwviqdyinekwspllyqeviranksli