PDB entry 1t6k

View 1t6k on RCSB PDB site
Description: Crystal structure of phzF from Pseudomonas fluorescens 2-79
Class: isomerase
Keywords: phenazine, chorismate, phzF, enzyme, ISOMERASE
Deposited on 2004-05-06, released 2004-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PHZF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t6ka1, d1t6ka2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6kA (A:)
    mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
    riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
    iptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfh
    dmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgv
    eigrpslmfakaegraeqltrvevsgngvtfgrgtivl