PDB entry 1t6j

View 1t6j on RCSB PDB site
Description: crystal structure of phenylalanine ammonia lyase from rhodosporidium toruloides
Deposited on 2004-05-06, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.243
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t6ja_
  • Chain 'B':
    Domains in SCOP 1.71: d1t6jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6jA (A:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6jA (A:)
    ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
    eflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnslt
    rghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvh
    egkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqslt
    amtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeerqdryplrt
    spqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmektrl
    glaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghlanp
    vtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefefkkq
    fgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfaagt
    vvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqilya
    fvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6jB (B:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6jB (B:)
    ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
    eflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnslt
    rghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvh
    egkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqslt
    amtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeerqdryplrt
    spqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmektrl
    glaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghlanp
    vtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefefkkq
    fgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfaagt
    vvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqilya
    fvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla