PDB entry 1t6i

View 1t6i on RCSB PDB site
Description: Nickel Superoxide Dismutase (NiSOD) Apo Structure
Deposited on 2004-05-06, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.235
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t6ia_
  • Chain 'B':
    Domains in SCOP 1.69: d1t6ib_
  • Chain 'C':
    Domains in SCOP 1.69: d1t6ic_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6iA (A:)
    mhcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlw
    sdyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6iA (A:)
    gvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpp
    hfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6iB (B:)
    mhcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlw
    sdyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6iB (B:)
    vydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpph
    fekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t6iC (C:)
    mhcdlpcgvydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlw
    sdyfkpphfekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6iC (C:)
    vydpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlwsdyfkpph
    fekypelhqlvndtlkamsaakgskdpatgqkaldyiaqidkifwetkk