PDB entry 1t6g

View 1t6g on RCSB PDB site
Description: Crystal structure of the Triticum aestivum xylanase inhibitor-I in complex with aspergillus niger xylanase-I
Class: hydrolase inhibitor
Keywords: protein-protein complex, two beta-barrel domain structure, beta-jelly roll structure, HYDROLASE INHIBITOR
Deposited on 2004-05-06, released 2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t6ga_
  • Chain 'B':
    Compound: Xylanase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t6gb_
  • Chain 'C':
    Compound: endo-1,4-beta-xylanase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55329
      • engineered (49)
    Domains in SCOPe 2.06: d1t6gc_
  • Chain 'D':
    Compound: endo-1,4-beta-xylanase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55329
      • engineered (49)
    Domains in SCOPe 2.06: d1t6gd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6gA (A:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
    laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
    gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
    vllrpdvyrplmdaftkalaaqhangapvaraveavapfgvcydtktlgnnlggyavpnv
    qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
    dmekkrlgfsrlphftgcggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6gA (A:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacapskll
    aslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwpqftq
    smpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpdvyrp
    lmdaftkalaaqgapvaraveavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmt
    gknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldfdmekkrlgfsrlp
    hftgcggl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6gB (B:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
    laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
    gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
    vllrpdvyrplmdaftkalaaqhangapvaraveavapfgvcydtktlgnnlggyavpnv
    qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
    dmekkrlgfsrlphftgcggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6gB (B:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacapskll
    aslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwpqftq
    smpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpdvyrp
    lmdaftkalaaqgapvaraveavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmt
    gknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldfdmekkrlgfsrlp
    hftgcggl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t6gC (C:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6gC (C:)
    aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
    gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
    tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
    is
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t6gD (D:)
    saginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysa
    sgsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtneps
    itgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasv
    tiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6gD (D:)
    aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
    gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
    tgtstftqyfsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
    is