PDB entry 1t6e

View 1t6e on RCSB PDB site
Description: Crystal Structure of the Triticum aestivum xylanase inhibitor I
Class: hydrolase inhibitor
Keywords: two beta-barrel domain structure, HYDROLASE INHIBITOR
Deposited on 2004-05-06, released 2004-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Xylanase inhibitor
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t6ex_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1t6eX (X:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
    laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
    gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
    vllrpdvyrplmdaftkalaaqhangapvaraveavapfgvcydtktlgnnlggyavpnv
    qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
    dmekkrlgfsrlphftgcggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6eX (X:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapsckpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacap
    skllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwp
    qftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpd
    vyrplmdaftkalaaqaraveavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmt
    gknsmvdvkqgtacvafvemkgvapavilggaqmedfvldfdmekkrlgfsrlphftgcg
    gl