PDB entry 1t6e

View 1t6e on RCSB PDB site
Description: Crystal Structure of the Triticum aestivum xylanase inhibitor I
Deposited on 2004-05-06, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.69: d1t6ex_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1t6eX (X:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapscgsdkhdkpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgv
    laacapskllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgg
    gpvpwpqftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpy
    vllrpdvyrplmdaftkalaaqhangapvaraveavapfgvcydtktlgnnlggyavpnv
    qlgldggsdwtmtgknsmvdvkqgtacvafvemkgvaagdgrapavilggaqmedfvldf
    dmekkrlgfsrlphftgcggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6eX (X:)
    lpvlapvtkdpatslytipfhdgaslvldvagplvwstcdggqppaeipcssptcllana
    ypapgcpapsckpctaypynpvsgacaagslshtrfvanttdgskpvskvnvgvlaacap
    skllaslprgstgvaglansglalpaqvasaqkvanrfllclptggpgvaifgggpvpwp
    qftqsmpytplvtkggspahyisarsivvgdtrvpvpegalatggvmlstrlpyvllrpd
    vyrplmdaftkalaaqaraveavapfgvcydtktlgnnlggyavpnvqlgldggsdwtmt
    gknsmvdvkqgtacvafvemkgvapavilggaqmedfvldfdmekkrlgfsrlphftgcg
    gl