PDB entry 1t6d

View 1t6d on RCSB PDB site
Description: MIRAS phasing of the Aquifex aeolicus Ppx/GppA phosphatase: crystal structure of the type II variant
Class: hydrolase
Keywords: alpha/beta protein, Actin-like fold, HYDROLASE
Deposited on 2004-05-06, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exopolyphosphatase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: ppx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67040
      • modified residue (11)
      • engineered (84)
      • engineered (140)
      • modified residue (291)
      • engineered (308)
    Domains in SCOPe 2.06: d1t6da1, d1t6da2
  • Chain 'B':
    Compound: exopolyphosphatase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: ppx
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67040
      • modified residue (11)
      • engineered (84)
      • engineered (140)
      • modified residue (291)
      • engineered (308)
    Domains in SCOPe 2.06: d1t6db1, d1t6db2
  • Heterogens: CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6dA (A:)
    gshmsldnkpimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqe
    drieetiqvlkeykklidefkvermkavateairraknaeeflervkrevglvvevitpe
    qegryaylavayslkpegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkq
    dppteeevkrffeflekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvlt
    ygqikkwfdtfkeipseerskrfrqvedrrakvilagigiflktleifekdclivsdwgl
    regvlvsemlkenhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6dA (A:)
    imrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqvl
    keykklidefkvermkavateairraknaeeflervkrevglvvevitpeqegryaylav
    ayslkpegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkr
    ffeflekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdt
    fkeipseerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvseml
    ken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6dB (B:)
    gshmsldnkpimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqe
    drieetiqvlkeykklidefkvermkavateairraknaeeflervkrevglvvevitpe
    qegryaylavayslkpegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkq
    dppteeevkrffeflekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvlt
    ygqikkwfdtfkeipseerskrfrqvedrrakvilagigiflktleifekdclivsdwgl
    regvlvsemlkenhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6dB (B:)
    imrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqvl
    keykklidefkvermkavateairraknaeeflervkrevglvvevitpeqegryaylav
    ayslkpegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkr
    ffeflekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdt
    fkeipseerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvseml