PDB entry 1t6c

View 1t6c on RCSB PDB site
Description: Structural characterization of the Ppx/GppA protein family: crystal structure of the Aquifex aeolicus family member
Class: hydrolase
Keywords: alpha/beta protein, Actin-like fold, HYDROLASE
Deposited on 2004-05-06, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.162
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exopolyphosphatase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: ppx
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t6ca1, d1t6ca2
  • Heterogens: IOD, CA, CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6cA (A:)
    gshmsldnkpimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqe
    drieetiqvlkeykklidefkvervkavateairraknaeeflervkrevglvvevitpe
    qegryaylavayslkpegevcvvdqgggsteyvfgkgykvrevislpigivnltetffkq
    dppteeevkrffeflekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvlt
    ygqikkwfdtfkeipseerskrfrqvedrrakvilagigiflktleifekdclivsdwgl
    regvlvsevlkenhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6cA (A:)
    pimrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv
    lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla
    vayslkpegevcvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevk
    rffeflekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfd
    tfkeipseerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvsev
    lkenhs