PDB entry 1t6b

View 1t6b on RCSB PDB site
Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor
Class: membrane protein/toxin
Keywords: Bacillus Anthracis; Anthrax toxin; X-ray crystallography, MEMBRANE PROTEIN-TOXIN COMPLEX
Deposited on 2004-05-05, released 2004-07-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Protective antigen
    Species: Bacillus anthracis [TaxId:1392]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1t6bx_
  • Chain 'Y':
    Compound: Anthrax toxin receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ANTXR2,CMG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1t6by_
  • Heterogens: CA, MN, NA, PG4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1t6bX (X:)
    evkqenrllnesesssqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyf
    qsaiwsgfikvkksdeytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqy
    qrenptekgldfklywtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdn
    dgipdslevegytvdvknkrtflspwisnihekkgltkyksspekwstasdpysdfekvt
    gridknvspearhplvaaypivhvdmeniilsknedqstqntdsqtrtiskntstsrtht
    sevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagertwaetmglntadtarl
    naniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapia
    lnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsev
    lpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnl
    qyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydr
    nniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindry
    dmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstng
    ikkilifskkgyeig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6bX (X:)
    sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
    eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
    wtdsqnkkevissdnlqlpelkqvpdrdndgipdslevegytvdvknkrtflspwisnih
    ekkgltkyksspekwstasdpysdfekvtgridknvspearhplvaaypivhvdmeniil
    sknetiskntstsrthtsevvsagfsnsnsstvaidhslslagertwaetmglntadtar
    lnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapi
    alnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwse
    vlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngn
    lqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhyd
    rnniavgadesvvkeahrevinssteglllnidkdirkilsgyiveiedteglkevindr
    ydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstn
    gikkilifskkgyeig
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1t6bY (Y:)
    gshmledprgrrafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqa
    tiilpltgdrgkiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdg
    kldglvpsyaekeakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgi
    inssngiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6bY (Y:)
    rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
    kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
    keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgii