PDB entry 1t6a

View 1t6a on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, Bacillus stearothermophilus, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-05-05, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RBSTP2229 gene product
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t6aa_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6aA (A:)
    amntdlklpagktmtiedvkqlleryqmalkktgeqlgwayeqaafpytvrihesvlylq
    gdgrlykgmaisvrtageetfidialppgathgdkgkanefskwlaktlggelhlfsgrt
    mvfgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6aA (A:)
    amntdlklpagktmtiedvkqlleryqmalkktgeqlgwayeqaafpytvrihesvlylq
    gdgrlykgmaisvrtageetfidialppgathgdkgkanefskwlaktlggelhlfsgrt
    mvfg