PDB entry 1t68

View 1t68 on RCSB PDB site
Description: Crystal structure of nitrophorin 2 complex with NO
Class: transport protein
Keywords: beta barrel, lipocalin, heme, nitric oxide, ruffling, TRANSPORT PROTEIN
Deposited on 2004-05-05, released 2005-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.195
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (1-179)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d1t68x2, d1t68x3
  • Heterogens: HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t68X (X:)
    mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
    ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
    iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl