PDB entry 1t67

View 1t67 on RCSB PDB site
Description: Crystal Structure of Human HDAC8 complexed with MS-344
Class: hydrolase
Keywords: histone deacetylase, zinc hydrolase, hydrolase
Deposited on 2004-05-05, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.215
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BY41 (Start-376)
      • conflict (30)
    Domains in SCOPe 2.07: d1t67a_
  • Heterogens: ZN, NA, B3N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t67A (A:)
    meepeepadsgqslvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpk
    vasmeematfhtdaylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggati
    taaqclidgmckvainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlh
    hgdgvedafsftskvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdeky
    yqicesvlkevyqafnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatli
    lggggynlantarcwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrneph
    riqqilnyikgnlkhvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t67A (A:)
    lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
    aylqhlqkvsqdsieyglgydcpategifdyaaaiggatitaaqclidgmckvainwsgg
    whhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvsl
    hkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkav
    vlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltg
    vilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkhvv