PDB entry 1t66

View 1t66 on RCSB PDB site
Description: The structure of FAB with intermediate affinity for fluorescein.
Class: immune system
Keywords: Antibody, Fab, Fluorescein, IMMUNE SYSTEM
Deposited on 2004-05-05, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: immunoglobulin light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAH19760 (0-218)
      • conflict (100)
      • conflict (171)
    Domains in SCOPe 2.06: d1t66c1, d1t66c2
  • Chain 'D':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T66 (0-219)
    Domains in SCOPe 2.06: d1t66d1, d1t66d2
  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T66 (0-219)
    Domains in SCOPe 2.06: d1t66h1, d1t66h2
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAH19760 (0-218)
      • conflict (100)
      • conflict (171)
    Domains in SCOPe 2.06: d1t66l1, d1t66l2
  • Heterogens: FLU, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66C (C:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66D (D:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsaak
    ttapsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsaly
    tltssvtvpssswpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66H (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsaak
    ttapsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsaly
    tltssvtvpssswpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66L (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec