PDB entry 1t65

View 1t65 on RCSB PDB site
Description: Crystal structure of the androgen receptor ligand binding domain with DHT and a peptide derived form its physiological coactivator GRIP1 NR box 2 bound in a non-helical conformation
Class: hormone/growth factor
Keywords: androgen receptor ligand binding domain GRIP1 NR box2 coactivators crystal structure non-helical, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2004-05-05, released 2005-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AR, NR3C4, DHTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t65a_
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, TIF2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t65A (A:)
    cqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnl
    hvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmr
    hlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrkn
    ptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkils
    gkvkpiyfhtq
    

  • Chain 'B':
    No sequence available.