PDB entry 1t62

View 1t62 on RCSB PDB site
Description: Crystal structure of protein EF3133 from Enterococcus faecalis V583, Pfam DUF984
Class: Structural genomics, unknown function
Keywords: NYSGXRC, target T1587, unknown function, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Structural genomics
Deposited on 2004-05-05, released 2004-06-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.215
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZD1
      • expression tag (161-165)
    Domains in SCOPe 2.05: d1t62a_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82ZD1 (0-155)
      • expression tag (156-165)
    Domains in SCOPe 2.05: d1t62b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t62A (A:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
    arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t62A (A:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk
    eelapyqlqfypdmllvcqsfevvdlythhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t62B (B:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
    arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t62B (B:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegltldywyeeharf
    fkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh