PDB entry 1t62

View 1t62 on RCSB PDB site
Description: crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984
Deposited on 2004-05-05, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.215
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t62a_
  • Chain 'B':
    Domains in SCOP 1.69: d1t62b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t62A (A:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
    arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t62A (A:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegldywyeeharffk
    eelapyqlqfypdmllvcqsfevvdlythhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t62B (B:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
    arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t62B (B:)
    mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
    eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegltldywyeeharf
    fkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh