PDB entry 1t5y

View 1t5y on RCSB PDB site
Description: Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-05-05, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Saccharomyces cerevisiae Nip7p homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y221 (10-End)
      • modified residue (10)
      • modified residue (21)
      • modified residue (61)
      • modified residue (145)
      • modified residue (168)
    Domains in SCOPe 2.07: d1t5ya1, d1t5ya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5yA (A:)
    mghhhhhhshmrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsek
    imklaanisgdklvslgtcfgkftkthkfrlhvtaldylapyakykvwikpgaeqsflyg
    nhvlksglgritentsqyqgvvvysmadiplgfgvaakstqdcrkvdpmaivvfhqadig
    eyvrheetlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5yA (A:)
    mrplteeetrvmfekiakyigenlqllvdrpdgtycfrlhndrvyyvsekimklaanisg
    dklvslgtcfgkftkthkfrlhvtaldylapyakykvwikpgaeqsflygnhvlksglgr
    itentsqyqgvvvysmadiplgfgvaakstqdcrkvdpmaivvfhqadig