PDB entry 1t5o

View 1t5o on RCSB PDB site
Description: crystal structure of the translation initiation factor eif-2b, subunit delta, from a. fulgidus
Deposited on 2004-05-04, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t5oa_
  • Chain 'B':
    Domains in SCOP 1.69: d1t5ob_
  • Chain 'C':
    Domains in SCOP 1.69: d1t5oc_
  • Chain 'D':
    Domains in SCOP 1.69: d1t5od_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5oA (A:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oA (A:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t5oB (B:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oB (B:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t5oC (C:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oC (C:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t5oD (D:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oD (D:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf