PDB entry 1t5o

View 1t5o on RCSB PDB site
Description: Crystal structure of the translation initiation factor eIF-2B, subunit delta, from A. fulgidus
Class: translation
Keywords: translation initiation factor, subunit delta, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, translation
Deposited on 2004-05-04, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor eIF2B, subunit delta
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29877 (3-340)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1t5oa1, d1t5oa2
  • Chain 'B':
    Compound: Translation initiation factor eIF2B, subunit delta
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29877 (3-340)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1t5ob1, d1t5ob2
  • Chain 'C':
    Compound: Translation initiation factor eIF2B, subunit delta
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29877 (3-340)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1t5oc1, d1t5oc2
  • Chain 'D':
    Compound: Translation initiation factor eIF2B, subunit delta
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29877 (3-340)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1t5od1, d1t5od2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5oA (A:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oA (A:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t5oB (B:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oB (B:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t5oC (C:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oC (C:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t5oD (D:)
    mslrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygial
    aarerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalr
    eaeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgke
    irviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrda
    vfnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapl
    nvkvynpafdptplenvtaliteygviyppyevnvpkvlkfeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5oD (D:)
    slrsifwddglklidqtklpekleviecrnveeladaikklavrgapaleaagaygiala
    arerefadvdelkehlkkaadflastrptavnlfvgieralnaalkgesveevkelalre
    aeklaeedvernrkmgeygaelledgdvvltycnagrlatvdwgtalgvvrsaveqgkei
    rviacetrplnqgsrltcwelmedgidvtlitdsmvgivmqkgmvdkvivgadrivrdav
    fnkigtytvsvvakhhnipfyvaapkatfdwertakdvvieerpreelifcgkrqiapln
    vkvynpafdptplenvtaliteygviyppyevnvpkvlkf