PDB entry 1t5l

View 1t5l on RCSB PDB site
Description: Crystal structure of the DNA repair protein UvrB point mutant Y96A revealing a novel fold for domain 2
Class: DNA excision repair
Keywords: Crystallography, DNA damage, DNA repair, Nucleotide Excision Repair, UvrB, UvrA, UvrC, NER, Mfd, TRCF
Deposited on 2004-05-04, released 2004-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UvrABC system protein B
    Species: Bacillus caldotenax
    Gene: uvrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56981 (0-End)
      • see remark 999 (189)
      • see remark 999 (232)
    Domains in SCOP 1.73: d1t5la1, d1t5la2
  • Chain 'B':
    Compound: UvrABC system protein B
    Species: Bacillus caldotenax
    Gene: uvrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56981 (0-End)
      • see remark 999 (189)
      • see remark 999 (232)
    Domains in SCOP 1.73: d1t5lb1, d1t5lb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5lA (A:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdviraty
    aaeetemyeakpaaamtkqereelirtleaemkeaakaldferaaqlrdiifelkaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5lA (A:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t5lB (B:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdviraty
    aaeetemyeakpaaamtkqereelirtleaemkeaakaldferaaqlrdiifelkaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5lB (B:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyaqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgevlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdv