PDB entry 1t5k

View 1t5k on RCSB PDB site
Description: Crystal structure of amicyanin substituted with cobalt
Class: electron transport
Keywords: electron transport
Deposited on 2004-05-04, released 2004-07-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.184
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1t5ka_
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1t5kb_
  • Chain 'C':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1t5kc_
  • Chain 'D':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1t5kd_
  • Heterogens: CO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t5kA (A:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t5kB (B:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t5kC (C:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t5kD (D:)
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve