PDB entry 1t5j

View 1t5j on RCSB PDB site
Description: Crystal structure of ribosylglycohydrolase MJ1187 from Methanococcus jannaschii
Class: structural genomics, unknown function
Keywords: putative hydrolase, structural genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2004-05-04, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein MJ1187
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58588 (3-302)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1t5ja1, d1t5ja2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5jA (A:)
    mslvkmrdkilgsvfgavigdalgmptenltkeeikklygfvdsyvepknylagklnkge
    wtddteqaicliksltkegidikkfancliawknknppdigltslmaidklenndysgvd
    ssscgaamriyplgivfhnnlkklkeevikaskithnnktaiagalaiaffvssalkdrk
    dfslldecynyikdideefakklleiknfnnldyiydyfgtgvktdevvpsaiatylltd
    nfkegmlkcinaggdtdslasmygamagayygfknipkewidglknkevifelaerlyhl
    ateeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5jA (A:)
    lvkmrdkilgsvfgavigdalgmptenltkeeikklygfvdsyvepknylagklnkgewt
    ddteqaicliksltkegidikkfancliawknknppdigltslmaidklenndysgvdss
    scgaamriyplgivfhnnlkklkeevikaskithnnktaiagalaiaffvssalkdrkdf
    slldecynyikdideefakklleiknfnnldyiydyfgtgvktdevvpsaiatylltdnf
    kegmlkcinaggdtdslasmygamagayygfknipkewidglknkevifelaerlyhlat
    e