PDB entry 1t5i

View 1t5i on RCSB PDB site
Description: Crystal structure of the C-terminal domain of UAP56
Deposited on 2004-05-04, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t5ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5iA (A:)
    gslhglqqyyvklkdneknrklfdlldvlefnqvvifvksvqrcialaqllveqnfpaia
    ihrgmpqeerlsryqqfkdfqrrilvatnlfgrgmdiervniafnydmpedsdtylhrva
    ragrfgtkglaitfvsdendakilndvqdrfevniselpdeidissyieqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5iA (A:)
    glqqyyvklkdneknrklfdlldvlefnqvvifvksvqrcialaqllveqnfpaiaihrg
    mpqeerlsryqqfkdfqrrilvatnlfgrgmdiervniafnydmpedsdtylhrvaragr
    fgtkglaitfvsdendakilndvqdrfevniselpeqtr