PDB entry 1t5h

View 1t5h on RCSB PDB site
Description: 4-chlorobenzoyl-coa ligase/synthetase unliganded, selenomethionine
Deposited on 2004-05-04, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.69: d1t5hx_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1t5hX (X:)
    mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
    apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavgrqvadaifqs
    gsgariiflgdlvrdgepysygppiedpqrepaqpafifytsgttglpkaaiipqraaes
    rvlfmstqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlv
    qqeqvtslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgek
    vniygtteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasds
    afvgylnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseierv
    lgtapgvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryf
    ildqlpknalnkvlrrqlvqqvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5hX (X:)
    mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
    apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavqvadaifqsgs
    gariiflgdlvrdgepysygppiedpqrepaqpafifytsglpkaaiipqraaesrvlfm
    stqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlvqqeqv
    tslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgekvniyg
    tteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasdsafvgy
    lnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseiervlgtap
    gvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryfildql
    pknalnkvlrrqlvqqvs