PDB entry 1t5h

View 1t5h on RCSB PDB site
Description: 4-Chlorobenzoyl-CoA Ligase/Synthetase unliganded, selenomethionine
Class: ligase
Keywords: Adenylate-forming coenzyme A Ligase domain alternation conformational change, LIGASE
Deposited on 2004-05-04, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 4-chlorobenzoyl CoA ligase
    Species: Alcaligenes sp. AL3007 [TaxId:206162]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8GN86 (0-End)
      • modified residue (0)
      • modified residue (6)
      • see remark 999 (42)
      • see remark 999 (44)
      • see remark 999 (77)
      • modified residue (101)
      • see remark 999 (150-151)
      • modified residue (184)
      • modified residue (202)
      • see remark 999 (258)
      • modified residue (283)
      • modified residue (309)
      • modified residue (314)
      • see remark 999 (316-317)
      • modified residue (323)
      • modified residue (403)
      • see remark 999 (427)
      • see remark 999 (496-497)
    Domains in SCOPe 2.08: d1t5hx_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1t5hX (X:)
    mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
    apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavgrqvadaifqs
    gsgariiflgdlvrdgepysygppiedpqrepaqpafifytsgttglpkaaiipqraaes
    rvlfmstqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlv
    qqeqvtslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgek
    vniygtteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasds
    afvgylnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseierv
    lgtapgvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryf
    ildqlpknalnkvlrrqlvqqvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5hX (X:)
    mqtvnemlrraatrapdhcalavparglrlthaelrarveavaarlhadglrpqqrvavv
    apnsadvviailalhrlgavpallnprlksaelaelikrgemtaaviavqvadaifqsgs
    gariiflgdlvrdgepysygppiedpqrepaqpafifytsglpkaaiipqraaesrvlfm
    stqvglrhgrhnvvlglmplyhvvgffavlvaalaldgtyvvveefrpvdalqlvqqeqv
    tslfatpthldalaaaaahagsslkldslrhvtfagatmpdavletvhqhlpgekvniyg
    tteamnslymrqpktgtemapgffsevrivrigggvdeivangeegelivaasdsafvgy
    lnqpqataeklqdgwyrtsdvavwtpegtvrilgrvddmiisggenihpseiervlgtap
    gvtevvvigladqrwgqsvtacvvprlgetlsadaldtfcrsseladfkrpkryfildql
    pknalnkvlrrqlvqqvs