PDB entry 1t5b

View 1t5b on RCSB PDB site
Description: Structural genomics, A protein from Salmonella typhimurium similar to E. coli acyl carrier protein phosphodiesterase
Class: hydrolase
Keywords: structural genomics, acyl carrier protein phosphodiesterase, FMN, Alpha/beta/alpha sandwich, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2004-05-03, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein phosphodiesterase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: ACPD, STM1642, STY1427, T1545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t5ba_
  • Chain 'B':
    Compound: Acyl carrier protein phosphodiesterase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: ACPD, STM1642, STY1427, T1545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t5bb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t5bA (A:)
    mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamr
    pgdapltprqqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfr
    ytekgpeglvtgkravvlssrggihkdtptdliapylkvflgfigitdvnfvfaegiayg
    pevaakaqadakaaidsvvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5bA (A:)
    mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamr
    dapltprqqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfryt
    ekgpeglvtgkravvlssrggihkdtptdliapylkvflgfigitdvnfvfaegiaygpe
    vaakaqadakaaidsvvaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t5bB (B:)
    mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamr
    pgdapltprqqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfr
    ytekgpeglvtgkravvlssrggihkdtptdliapylkvflgfigitdvnfvfaegiayg
    pevaakaqadakaaidsvvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t5bB (B:)
    mskvlvlkssilagysqsgqltdyfieqwrekhvadeitvrdlaanpvpvldgelvgamr
    apltprqqdalalsdeliaelkahdviviaapmynfniptqlknyfdliaragitfryte
    kgpeglvtgkravvlssrggihkdtptdliapylkvflgfigitdvnfvfaegiaygpev
    aakaqadakaaidsvvaa