PDB entry 1t4z

View 1t4z on RCSB PDB site
Description: Solution structure of the N-terminal domain of Synechococcus elongatus SasA (25-structures ensemble)
Deposited on 2004-04-30, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1t4za_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t4zA (A:)
  gsslspqalaqplllqlfvdtrplsqhivqrvknilaaveatvpislqvinvadqpqlve
  yyrlvvtpalvkigpgsrqvlsgidltdqlanqlpqwlvqqegif