PDB entry 1t4w

View 1t4w on RCSB PDB site
Description: Structural Differences in the DNA Binding Domains of Human p53 and its C. elegans Ortholog Cep-1: Structure of C. elegans Cep-1
Class: transcription
Keywords: DNA-Binding Domain, TRANSCRIPTION
Deposited on 2004-04-30, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C.Elegans p53 tumor suppressor-like transcription factor
    Species: Caenorhabditis elegans [TaxId:6239]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t4wa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4wA (A:)
    ekwmeidvlkqkvakssdmafaissehekylwtkmgclvpiqvkwkldkrhfnsnlslri
    rfvkydkkenveyairnprsdvmkcrshtereqhfpfdsffyirnsehefsysaekgstf
    tlimypgavqanfdiifmcqekcldlddrrktmclavflddengneilhayikqvrivay
    prrdwknfceredakq