PDB entry 1t4p

View 1t4p on RCSB PDB site
Description: Arginase-dehydro-ABH complex
Class: hydrolase
Keywords: arginase, dehydro-ABH, HYDROLASE
Deposited on 2004-04-30, released 2005-04-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.264
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t4pa_
  • Chain 'B':
    Compound: arginase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t4pb_
  • Chain 'C':
    Compound: arginase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t4pc_
  • Heterogens: MN, 2BH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4pA (A:)
    kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
    ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
    htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
    ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
    tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
    tkregnhkpetdyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4pB (B:)
    kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
    ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
    htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
    ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
    tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
    tkregnhkpetdyl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4pC (C:)
    kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
    ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
    htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
    ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
    tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
    tkregnhkpetdyl