PDB entry 1t4o

View 1t4o on RCSB PDB site
Description: Crystal structure of rnt1p dsRBD
Class: hydrolase
Keywords: Rnt1p, dsRBD, RNA-binding
Deposited on 2004-04-30, released 2004-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Saccharomyces cerevisiae
    Gene: RNT1, YMR239C, YM9408.01C, YM9959.21
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t4oa_
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Saccharomyces cerevisiae
    Gene: RNT1, YMR239C, YM9408.01C, YM9959.21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02555 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.73: d1t4ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t4oA (A:)
    mktdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrni
    kiagiraaenalrdkkmldfyakqraaiprsesvlkdpsqknkkrkfsdtshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t4oA (A:)
    tdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrniki
    agiraaenalrdkkmldfyak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t4oB (B:)
    mktdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrni
    kiagiraaenalrdkkmldfyakqraaiprsesvlkdpsqknkkrkfsdtshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t4oB (B:)
    mktdkldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrni
    kiagiraaenalrdkkmldfyakqraai