PDB entry 1t4l

View 1t4l on RCSB PDB site
Description: Solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (Rnt1p) in complex with the 5' terminal RNA hairpin of snR47 precursor
Class: RNA binding protein/RNA
Keywords: dsRBD, RNase III, AGNN tetraloop, protein-RNA complex, RNA BINDING PROTEIN/RNA COMPLEX
Deposited on 2004-04-29, released 2004-06-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5' terminal hairpin of snR47 precursor
  
• Chain 'B':
  Compound: Ribonuclease III
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: RNT1, YMR239C, YM9408.01C, YM9959.21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02555 (2-89)
    • cloning artifact (0-1)
  Domains in SCOPe 2.04: d1t4lb_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t4lB (B:)
  gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
  giraaenalrdkkmldfyakqraaiprses