PDB entry 1t4l

View 1t4l on RCSB PDB site
Description: Solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (Rnt1p) in complex with the 5' terminal RNA hairpin of snR47 precursor
Class: RNA binding protein/RNA
Keywords: dsRBD, RNase III, AGNN tetraloop, protein-RNA complex
Deposited on 2004-04-29, released 2004-06-01
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-08, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5' terminal hairpin of snR47 precursor
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Saccharomyces cerevisiae
    Gene: RNT1, YMR239C, YM9408.01C, YM9959.21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02555 (2-89)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1t4lb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4lB (B:)
    gsldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikia
    giraaenalrdkkmldfyakqraaiprses