PDB entry 1t4k

View 1t4k on RCSB PDB site
Description: Crystal Structure of Unliganded Aldolase Antibody 93F3 Fab
Class: immune system
Keywords: enantioselectivity, aldolase antibody, reactive lysine, aldol reaction
Deposited on 2004-04-29, released 2004-11-02
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin igg1, kappa light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1t4ka1, d1t4ka2
  • Chain 'B':
    Compound: immunoglobulin igg1, heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1t4kb1, d1t4kb2
  • Chain 'C':
    Compound: immunoglobulin igg1, kappa light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1t4kc1, d1t4kc2
  • Chain 'D':
    Compound: immunoglobulin igg1, heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1t4kd1, d1t4kd2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4kA (A:)
    diqmtqspsslavspgekvtmscrssqslfnsrtrknylawyqqkpgqsptkliywastr
    esgvpdrftgsgsgtdftltissvqaedlaiyyckqsydlptfgagtklelkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4kB (B:)
    evmlvesgpglvapsqslsitctvsgfslsdygvswirqppgkglewlgviwgdgstyya
    salkfrltiskdssksqvflnmhslqtddsamyycakhtyggpgdswgqgtsvtvssast
    tppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4kC (C:)
    diqmtqspsslavspgekvtmscrssqslfnsrtrknylawyqqkpgqsptkliywastr
    esgvpdrftgsgsgtdftltissvqaedlaiyyckqsydlptfgagtklelkrsdaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4kD (D:)
    evmlvesgpglvapsqslsitctvsgfslsdygvswirqppgkglewlgviwgdgstyya
    salkfrltiskdssksqvflnmhslqtddsamyycakhtyggpgdswgqgtsvtvssast
    tppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpssprpsetvtcnvahpasstkvdkkivpr