PDB entry 1t4h

View 1t4h on RCSB PDB site
Description: Crystal structure of the kinase domain of WNK1, a kinase that causes a hereditary form of hypertension
Class: transferase
Keywords: WNK1, protein serine/threonine kinase, transferase
Deposited on 2004-04-29, released 2004-07-20
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus
    Gene: PKRWNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIH7
      • modified residue (20)
      • modified residue (77)
      • modified residue (110)
      • modified residue (125)
      • engineered (188)
      • modified residue (196)
      • modified residue (200)
      • modified residue (216)
      • modified residue (218)
      • modified residue (221)
      • modified residue (188)
    Domains in SCOP 1.73: d1t4ha_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus
    Gene: PKRWNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIH7
      • modified residue (20)
      • modified residue (77)
      • modified residue (110)
      • modified residue (125)
      • modified residue (200)
      • modified residue (216)
      • modified residue (218)
      • modified residue (221)
    Domains in SCOP 1.73: d1t4hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t4hA (A:)
    qeernqqqddieeletkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelq
    drkltkserqrfkeeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktyl
    krfkvmkikvlrswcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglat
    lkrasfakavigtpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyr
    rvtsgvkpasfdkvaipevkeiiegcirqnkderysikdllnhaffqeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t4hA (A:)
    avgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeeae
    mlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcrq
    ilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfakavigtpefm
    apemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvaip
    evkeiiegcirqnkderysikdllnhaffq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t4hB (B:)
    qeernqqqddieeletkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelq
    drkltkserqrfkeeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktyl
    krfkvmkikvlrswcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglat
    lkrasfakavigtpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyr
    rvtsgvkpasfdkvaipevkeiiegcirqnkderysikdllnhaffqeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t4hB (B:)
    kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
    emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmapemyeekyd
    esvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvaipevkeiiegci
    rqnkderysikdllnhaffqe