PDB entry 1t4f

View 1t4f on RCSB PDB site
Description: Structure of human MDM2 in complex with an optimized p53 peptide
Class: ligase
Keywords: MDM2-p53 peptide complex, p53-binding protein Mdm2 Oncoprotein Mdm2 Double minute 2 protein Hdm2, LIGASE
Deposited on 2004-04-29, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t4fm_
  • Chain 'P':
    Compound: optimized p53 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1T4F (0-8)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1t4fM (M:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t4fM (M:)
    eqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndll
    gdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'P':
    No sequence available.