PDB entry 1t4e

View 1t4e on RCSB PDB site
Description: Structure of Human MDM2 in complex with a Benzodiazepine Inhibitor
Class: ligase
Keywords: MDM2-Inhibitor complex, LIGASE
Deposited on 2004-04-29, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.239
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-95)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1t4ea2, d1t4ea3
  • Chain 'B':
    Compound: ubiquitin-protein ligase e3 mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-95)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1t4eb2, d1t4eb3
  • Heterogens: DIZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4eA (A:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4eB (B:)
    gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
    ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn