PDB entry 1t4d

View 1t4d on RCSB PDB site
Description: Crystal structure of Escherichia coli aspartate beta-semialdehyde dehydrogenase (EcASADH), at 1.95 Angstrom resolution
Class: oxidoreductase
Keywords: ASADH, aspartate semialdehyde dehydrogenase, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement, OXIDOREDUCTASE
Deposited on 2004-04-29, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD, HOM, B3433, Z4797, ECS4278, SF3456, S4307
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q9 (0-366)
      • engineered (1)
    Domains in SCOPe 2.06: d1t4da1, d1t4da2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD, HOM, B3433, Z4797, ECS4278, SF3456, S4307
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q9 (0-366)
      • engineered (1)
    Domains in SCOPe 2.06: d1t4db1, d1t4db2
  • Chain 'C':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD, HOM, B3433, Z4797, ECS4278, SF3456, S4307
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q9 (0-366)
      • engineered (1)
    Domains in SCOPe 2.06: d1t4dc1, d1t4dc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4dA (A:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4dB (B:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4dC (C:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla