PDB entry 1t4b

View 1t4b on RCSB PDB site
Description: 1.6 Angstrom structure of Esherichia coli aspartate-semialdehyde dehydrogenase.
Class: oxidoreductase
Keywords: ASADH, aspartate semialdehyde dehydrogenase, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement
Deposited on 2004-04-29, released 2004-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD, HOM, B3433, Z4797, ECS4278, SF3456, S4307
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q9 (0-366)
      • engineered (1)
    Domains in SCOPe 2.06: d1t4ba1, d1t4ba2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ASD, HOM, B3433, Z4797, ECS4278, SF3456, S4307
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A9Q9 (0-366)
      • engineered (1)
    Domains in SCOPe 2.06: d1t4bb1, d1t4bb2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4bA (A:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4bB (B:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla