PDB entry 1t4b

View 1t4b on RCSB PDB site
Description: 1.6 Angstrom structure of Esherichia coli aspartate-semialdehyde dehydrogenase.
Deposited on 2004-04-29, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4bA (A:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t4bB (B:)
    mqnvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
    ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
    dglnngirtfvggnctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmg
    hlyghvadelatpssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsr
    eewkgqaetnkilntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnp
    wakvvpndreitmreltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwgaaeplr
    rmlrqla