PDB entry 1t47

View 1t47 on RCSB PDB site
Description: Structure of fe2-HPPD bound to NTBC
Deposited on 2004-04-28, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t47A (A:)
    mtqtthhtpdtarqadpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsre
    tasyvltngsarfvltsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaieh
    garsvaepyelkdehgtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppahr
    tfqaidhcvgnvelgrmnewvgfynkvmgftnmkefvgddiateysalmskvvadgtlkv
    kfpinepalakkksqideylefyggagvqhialntgdivetvrtmraagvqfldtpdsyy
    dtlgewvgdtrvpvdtlrelkiladrdedgyllqiftkpvqdrptvffeiierhgsmgfg
    kgnfkalfeaiereqekrgnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t47A (A:)
    dpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsretasyvltngsarfvl
    tsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaiehgarsvaepyelkdeh
    gtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppahrtfqaidhcvgnvelg
    rmnewvgfynkvmgftnmkefvgddiateysalmskvvadgtlkvkfpinepalakkksq
    ideylefyggagvqhialntgdivetvrtmraagvqfldtpdsyydtlgewvgdtrvpvd
    tlrelkiladrdedgyllqiftkpvqdrptvffeiierhgsmgfgkgnfkalfeaiereq
    ek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t47B (B:)
    mtqtthhtpdtarqadpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsre
    tasyvltngsarfvltsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaieh
    garsvaepyelkdehgtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppahr
    tfqaidhcvgnvelgrmnewvgfynkvmgftnmkefvgddiateysalmskvvadgtlkv
    kfpinepalakkksqideylefyggagvqhialntgdivetvrtmraagvqfldtpdsyy
    dtlgewvgdtrvpvdtlrelkiladrdedgyllqiftkpvqdrptvffeiierhgsmgfg
    kgnfkalfeaiereqekrgnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t47B (B:)
    dpfpvkgmdavvfavgnakqaahyystafgmqlvaysgpengsretasyvltngsarfvl
    tsvikpatpwghfladhvaehgdgvvdlaievpdaraahayaiehgarsvaepyelkdeh
    gtvvlaaiatygktrhtlvdrtgydgpylpgyvaaapiveppahrtfqaidhcvgnvelg
    rmnewvgfynkvmgftnmkefvgddiateysalmskvvadgtlkvkfpinepalakkksq
    ideylefyggagvqhialntgdivetvrtmraagvqfldtpdsyydtlgewvgdtrvpvd
    tlrelkiladrdedgyllqiftkpvqdrptvffeiierhgsmgfgkgnfkalfeaiereq
    ek