PDB entry 1t46

View 1t46 on RCSB PDB site
Description: structural basis for the autoinhibition and sti-571 inhibition of c-kit tyrosine kinase
Class: transferase activator
Keywords: KINASE, STRUCTURE, INHIBITOR, STI-571, Gleevec, TRANSFERASE ACTIVATOR
Deposited on 2004-04-28, released 2004-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721 (0-End)
    • GB NP_000213
    Domains in SCOPe 2.06: d1t46a_
  • Heterogens: PO4, STI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t46A (A:)
    gnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkm
    lkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrr
    krdsficsktspaimeddelaldledllsfsyqvakgmaflaskncihrdlaarnillth
    gritkicdfglardikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwel
    fslgsspypgmpvdskfykmikegfrmlspehapaemydimktcwdadplkrptfkqivq
    liekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t46A (A:)
    gnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkm
    lkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrr
    krdsflaldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglard
    ikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvd
    skfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliekqisestn