PDB entry 1t45

View 1t45 on RCSB PDB site
Description: structural basis for the autoinhibition and sti-571 inhibition of c-kit tyrosine kinase
Class: transferase activator
Keywords: kinase, autoinhibition, transferase activator
Deposited on 2004-04-28, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721 (0-146)
      • see remark 999 (147-148)
    • GB NP_000213 (149-330)
    Domains in SCOPe 2.07: d1t45a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t45A (A:)
    ylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvvea
    taygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgactiggpt
    lviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakgmafla
    skncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmapesifnc
    vytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaemydimk
    tcwdadplkrptfkqivqliekqisestnhi