PDB entry 1t43

View 1t43 on RCSB PDB site
Description: Crystal Structure Analysis of E.coli Protein (N5)-Glutamine Methyltransferase (HemK)
Class: transferase
Keywords: Methyltransferase
Deposited on 2004-04-28, released 2004-06-29
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.289
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein methyltransferase hemK
    Species: Escherichia coli
    Gene: HEMK, B1212, SF1215, S1299
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t43a_
  • Heterogens: SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t43A (A:)
    meyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldallt
    rrrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgt
    gaialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfami
    vsnppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgw
    qqgeavrqafilagyhdvetcrdygdnervtlgryyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t43A (A:)
    eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltr
    rrdgepiahltgvrefwslplfvspatliprpdteclveqalarlpeqpcrildlgtgtg
    aialalaserpdceiiavdrmpdavslaqrnaqhlaiknihilqsdwfsalagqqfamiv
    snppyideqdphlqqgdvrfepltalvaadsgmadivhiieqsrnalvsggflllehgwq
    qgeavrqafilagyhdvetcrdygdnervtlgry